PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn372661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 416aa    MW: 46901.9 Da    PI: 6.1321
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn372661genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97e-31265320156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH rFv a++qLGG+++AtPk+i+e m+v+gLt++++kSHLQkYRl+
  Achn372661 265 KQRRCWSPELHWRFVTALQQLGGPQVATPKQIRERMQVDGLTNDEIKSHLQKYRLH 320
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.737262322IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-27263323IPR009057Homeodomain-like
SuperFamilySSF466891.18E-15263323IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-25265320IPR006447Myb domain, plants
PfamPF002499.1E-7267318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MYVMNDLNHR DSSPATTQRI LIEEDLRRRR KLGMGSIPPE LSLDIRPTFV PKTISRFLGE  60
ITEIGKISER LLRIEDFVKR LEDEMRKIDA FKRELPLSMM LLNDAIVILK EESVQCRTRN  120
IEPVLEEFIP LKKNCDEEEK IETIKVKDNR DKVDWMSSVQ LWNTDDTETT DSKKQNSIKG  180
GEEGCKKGTG SRAFMSFEEC LRKEDKEELS VAGLSLGIKN PRGKVSSSGL VSKTRGIRPV  240
SSSTPISKSN LRAGPLPLQY QNARKQRRCW SPELHWRFVT ALQQLGGPQV ATPKQIRERM  300
QVDGLTNDEI KSHLQKYRLH ARKPPAAANK STVNFGGLWL PPPQDDRFGA SVKQSNSKSG  360
SPKGPLQLDG GGTCTTGEDE EEDYDDDDDD DDDNDDDDGK SECYGWKIHI PKSGN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12531LRRRRKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284970.21e-130PREDICTED: uncharacterized protein LOC100267475 isoform X2
TrEMBLA5BS051e-131A5BS05_VITVI; Putative uncharacterized protein
STRINGVIT_03s0063g01060.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.12e-55G2-like family protein